| CD137L (mouse)-Fc Recombinant Purified Protein |
| |
|
|
|
| |
|
|
Catalog No |
: |
IMR-276-1000 |
|
|
|
|
 |
Description |
|
CD137L is a member of the TNF superfamily and provides costimulatory signals
to T cells. It is expressed on dendritic cells, activated macrophages, and B
cells. CD137L binds to its receptor CD137 on activated T-cells, this interaction
is important for adaptive T-cell response. The engagement of CD137 by CD137L
provides costimulation to both CD4+ and CD8+ cells. Agonist anti-CD137
monoclonal antibodies also have been used to stimulate CD137 to regulate T-cell
number and functions.
The Fc-CD137L fusion protein was generated by
cloning the extracellular domain of mouse CD137L with the Fc region of mouse
immunoglobulin (hinge region, CH2, CH3 domains). Fc-CD137L fusion protein has
comparable biological activities as 2A, an anti-CD137 agonist antibody. |
|
|
Formulation |
|
1 mg in 0.5 ml of phosphate-buffered solution, pH 7.2, containing no preservative. 0.2 um filter sterilized. |
|
|
Stability |
|
Aliquot and store at -70°C or colder. Avoid freeze-thaw steps. |
|
|
Purity |
|
Protein A Chromatography |
|
|
Amino Acid Sequence |
|
Fc-mCD137L MW: Approximately 70 kDa in SDS-PAGE of the glycosylated Fc-mCD137L fusion protein.
EPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVD
VSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWM
SGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTL
TCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKK
NWVERNSYSCSVVHEGLHNHHTTKSFSRTPGKSGRTEPRPALTITTSPNLG
TRENNADQVTPVSHIGCPNTTQQGSPVFAKLLAKNQASLCNTTLNWHSQD
GAGSSYLSQGLRYEEDKKELVVDSPGLYYVFLELKLSPTFTNTGHKVQGWV
SLVLQAKPQVDDFDNLALTVELFPCSMENKLVDRSWSQLLLLKAGHRLSVG
LRAYLHGAQDAYRDWELSYPNTTSFGLFLVKPDNPWE
Mouse Ig-Fc amino acid sequences are in Italics
Linker sequence (SGR) in bold
Mouse CD137L sequences are underlined |
|
|
Biological Activity |
|
In vitro proliferation assay, in vivo assays. |
|
|
Endotoxin |
|
Endotoxin level < 0.1 EU/ug of the protein (< 0.01 ng/ug of the protein) as determined by the LAL test. |
|
 |
|
|
|
Figure 1. Demonstration of the potency of mCD137L fusion protein in vitro in comparison to an agonist antibody 2A. Balb/c mouse splenocytes were incubated for 48-hrs on anti-CD3 (145-11C clone) monoclonal antibody coated plates in the presence of 2 mg/ml anti-CD3, 2A or Fc-mCD137L. The amount of IL-2 production induced by Fc-mCD137L was comparable to the induction by 2A antibody (Zhang N, et al, 2007). |
|
|
|
|
|
|
Figure 2. Electrophoretic analysis of the purified Fc-mCD137L
using Coomassie Blue stained 4-20% reducing SDS-PAGE. |
|
|
Reference
1.Targeted and untargeted CD137L fusion proteins for the Immunotherapy of experimental solid tumors. Zhang N, Sadun RE, Arias RS, Flanagan ML, Sachsman SM et al. Clin Cancer Res. 13: 2758-2767 (2007).
2.TNF/TNFR family members in costimulation of T cell responses. Annu Rev Immunol. 23: 23-28 (2005).
3.Molecular cloning of a ligand for the inducible T cell gene 4-1BB: a member of an emerging family of cytokines with homology to tumor necrosis factor. Eur J Immunol. 23: 2631-2641 (1993).
|
|
|
Product Citations
1. 1. Targeted and untargeted CD137L fusion proteins for the immunotherapy of experimental solid tumors. Zhang N, Sadun RE, Arias RS, Flanagan ML, Sachsman SM, et al. Clin Cancer Res 13 (9): 2758-2767 (2007). |
|
|
|
|
| Research purposes only.
Not for diagnostic or in vivo use. |
